DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG11664

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:212 Identity:53/212 - (25%)
Similarity:90/212 - (42%) Gaps:36/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSK-----FR--------QHESYL 121
            ||:....:|||.|||            ....|.||...|.:..:     ||        :|..:.
  Fly    49 GSLFSARYVLTVAHC------------FKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFS 101

  Fly   122 ALTIRNDISLIQT-SSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYV 185
            .||:||||::::. :::|.|..:|.|.|.:...:...........:||.|..     :::.|:.:
  Fly   102 PLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMH-----IAQPLKSM 161

  Fly   186 DLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLIG-ATSFGSADGCESG 249
            .:.:.....|::.|..  ::..|:|...|.....|.||||.||...|.:.| |.:|....  :..
  Fly   162 SVQVEPEKNCRQWFPQ--ISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCG--DKR 222

  Fly   250 APAAFTRITYYRDWIKE 266
            .||.||.:.|:|.:|.:
  Fly   223 YPALFTDVHYHRAFIAQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 52/208 (25%)
Tryp_SPc 40..267 CDD:238113 53/212 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/210 (25%)
Tryp_SPc 38..237 CDD:214473 52/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.