DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss30

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:126/278 - (45%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW-------CGGS 71
            |...:||::.. |.||       .|:|..|:||:.||:|:||.|         |       ||||
Mouse    56 ARGDILPSVCG-HSRD-------AGKIVGGQDALEGQWPWQVSL---------WITEDGHICGGS 103

  Fly    72 IIGNEWVLTAAHCTDGAASVTIYY----GATVRTSPEFTQVVSSSKFRQHESYL-ALTIRNDISL 131
            :|...||||||||...:.:.:.|:    |.|:......:.:|:......|.:|| |.....||:|
Mouse   104 LIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIAL 168

  Fly   132 IQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQ 196
            :|..:....:....:.|||.....:  .|.....:|||.|.::..|  ..||.:.:.::.:..|:
Mouse   169 VQLDTPLRPSQFTPVCLPAAQTPLT--PGTVCWVTGWGATQERDMA--SVLQELAVPLLDSEDCE 229

  Fly   197 ETF--------GSLIVTSRVLCVD-TTNKASTCQGDSGGPLAL----DGVLIGATSFGSADGC-E 247
            :.:        |..|:.|.:||.. ...:..:|||||||||..    ....:|.||:|.  || .
Mouse   230 KMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGI--GCAR 292

  Fly   248 SGAPAAFTRITYYRDWIK 265
            ...|..:||:..|.|||:
Mouse   293 PYRPGVYTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 73/250 (29%)
Tryp_SPc 40..267 CDD:238113 75/252 (30%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.