DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Cela3b

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:277 Identity:83/277 - (29%)
Similarity:128/277 - (46%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW--WC 68
            :|::||||...  .|:..|            :.|:.||:|||...:|:||.|.:... ||:  .|
  Rat     8 LLLVALASGCG--QPSYNP------------SSRVVNGEDAVPYSWPWQVSLQYEKD-GSFHHTC 57

  Fly    69 GGSIIGNEWVLTAAHCTDGAASVTIYYG---ATVRTSPEFTQVVSSSKFRQHESYLA--LTIRND 128
            ||::|..:||:||.||...:.:..:..|   ..|...||....|::.....|..:.:  ::..||
  Rat    58 GGTLIAPDWVMTAGHCISTSRTYQVVLGEFERGVEEGPEQVIPVNAGDLFVHPKWNSNCVSCGND 122

  Fly   129 ISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISN 192
            |:|::.| |.....||....||.......  .|.....||||..|.......: ||...|.::..
  Rat   123 IALVKLSRSAQLGDTVQLACLPPAGEILP--NGAPCYISGWGRLSTNGPLPDK-LQQALLPVVDY 184

  Fly   193 SKCQE-TFGSLIVTSRVLCVDTTNKASTCQGDSGGPL---ALDGV--LIGATSFGSADGCES-GA 250
            :.|.: .:....|...::|.. .:..|.|.|||||||   |.:|.  :.|.|||.|:.||.: ..
  Rat   185 AHCSKWDWWGFSVKKTMVCAG-GDIQSGCNGDSGGPLNCPAENGTWQVHGVTSFVSSLGCNTLKK 248

  Fly   251 PAAFTRITYYRDWIKET 267
            |..|||::.:.:||:||
  Rat   249 PTVFTRVSAFNEWIEET 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 72/239 (30%)
Tryp_SPc 40..267 CDD:238113 73/241 (30%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 72/239 (30%)
Tryp_SPc 28..265 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.