DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss34

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:292 Identity:87/292 - (29%)
Similarity:129/292 - (44%) Gaps:55/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW- 67
            |:.|.|....::..|.|:          |...:.| |..|....|.:||:||.|.|.:...|.| 
  Rat     8 FLFLTLPCLGSTMPLTPD----------SGQELVG-IVGGCPVSASRFPWQVSLRFYNMKLSKWE 61

  Fly    68 --CGGSIIGNEWVLTAAHCTD-----------GAASVTIYYGATVRTSPEFTQVVSSSKFRQHES 119
              ||||:|..:||||||||.:           ....:.:|         |..|::..:|..:|..
  Rat    62 HICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLY---------ENDQLMKVAKIIRHPK 117

  Fly   120 Y---LALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWG-LTSDQATAVS 179
            :   |:.....||:|:: .|:|..|..|:.:||||.|...|:  .||...:||| :...:.....
  Rat   118 FSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISS--KKTWWVAGWGVIEGHRPLPPP 180

  Fly   180 RDLQYVDLTIISNSKCQE---TFGSL-----IVTSRVLCVDTTNKASTCQGDSGGPLA----LDG 232
            ..|:.|.:.|:.||.|::   |:.||     |:...:||.....:.| ||.||||||.    ...
  Rat   181 CHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDS-CQADSGGPLVCRWNCSW 244

  Fly   233 VLIGATSFGSADGCESGAPAAFTRITYYRDWI 264
            |.:|..|:|...|... .|..:||:..|..||
  Rat   245 VQVGVVSWGIGCGLPD-FPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 78/255 (31%)
Tryp_SPc 40..267 CDD:238113 80/256 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 80/256 (31%)
Tryp_SPc 33..275 CDD:214473 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.