DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss27

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:282 Identity:79/282 - (28%)
Similarity:126/282 - (44%) Gaps:34/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCG 69
            ::|.|.|.|.:.|.....|..|||       :..|:..|:||:.|::|:||.:..:   |:.:||
  Rat    10 LLLPLLLRSGTEGAEAMRACGHPR-------MFNRMVGGEDALEGEWPWQVSIQRN---GAHFCG 64

  Fly    70 GSIIGNEWVLTAAHCTDGAASVTIY---YGATVRTSP-EFTQVVSSSKFRQHESYLALTIRNDIS 130
            ||:|...||||||||....:.::||   .||.....| .....|...:.:.|..|..:....|::
  Rat    65 GSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQPGPHALYVPVKRVKSHPEYQGMASSADVA 129

  Fly   131 LIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVS-RDLQYVDLTIISNS 193
            |::.. .|:|:..:..:.||..|..:.:  |.....:|||..|:|....: |.||.:.:.:|...
  Rat   130 LVELQVPVTFTKYILPVCLPDPSVVFKS--GMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTP 192

  Fly   194 KCQETFGS--------LIVTSRVLCVD-TTNKASTCQGDSGGPLAL----DGVLIGATSFGSADG 245
            ||...:..        ..:...:||.. ...|...|:|||||||..    ..|..|..|:|  :|
  Rat   193 KCNLLYSKDAEADIQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQSWVQAGVISWG--EG 255

  Fly   246 C-ESGAPAAFTRITYYRDWIKE 266
            | ....|..:.|:..:..||.:
  Rat   256 CARRNRPGVYIRVASHYQWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/244 (28%)
Tryp_SPc 40..267 CDD:238113 69/247 (28%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 68/244 (28%)
Tryp_SPc 39..278 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.