DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss30

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:285 Identity:80/285 - (28%)
Similarity:130/285 - (45%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW 67
            :|::|:..|......:|.:.|              |:|..|:||..|::|:||.|........  
  Rat     8 IFLLLLQILTGGRGDILHSGA--------------GKIVGGQDAPEGRWPWQVSLRTEKEGHI-- 56

  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYY----GATVR-TSPEFTQVVSSSKFRQHESYL-ALTIR 126
            ||||:|...||||||||.....:.:.|:    |.|:. |.|..|.|...:.| .:.:|| .....
  Rat    57 CGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLSLTEPHSTLVAVRNIF-VYPTYLWEDASS 120

  Fly   127 NDISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIIS 191
            .||:|::..:....:..:.:.||......:  .|.....:|||.|.::..|  ..||.:.:.::.
  Rat   121 GDIALLRLDTPLQPSQFSPVCLPQAQAPLT--PGTVCWVTGWGATHERELA--SVLQELAVPLLD 181

  Fly   192 NSKCQETF--------GSLIVTSRVLCVD-TTNKASTCQGDSGGPL--ALDG--VLIGATSFGSA 243
            :..|:..:        |..::.|.:||.. ...:..:|||||||||  |::.  :.:|.||:|. 
  Rat   182 SEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGI- 245

  Fly   244 DGC-ESGAPAAFTRITYYRDWIKET 267
             || ....|..:||:..|.|||:.|
  Rat   246 -GCARPNKPGVYTRVPDYVDWIQRT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/244 (29%)
Tryp_SPc 40..267 CDD:238113 73/246 (30%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.