DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG33462

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:255 Identity:62/255 - (24%)
Similarity:103/255 - (40%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGA-T 98
            :|:.|..|.|.|   |.|:   :::..:...:.|.|::|.:.:|||||||......:|:..|. .
  Fly    34 NISERSVNAKLA---QNPW---MAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYN 92

  Fly    99 VRTSPEFTQVVSSSKFRQ--------HESYLALTIRNDISLIQTS-SVSFSATVNKISLPAVSNS 154
            .:|..:....:....|::        |..|.|....|||.:::.. .|.:...:..|.:.| ||.
  Fly    93 TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA-SNR 156

  Fly   155 YS------TYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDT 213
            :.      |:...|.    |..|:  |.|.|:.|:.:::.......|.|.:| ..:|...:|...
  Fly   157 FQEPIDQLTWFTTTV----WRETA--ANATSKVLRTMNIDRQPKETCSEIYG-WNMTFEQICAGN 214

  Fly   214 TNKASTCQGDSGGP----LALDG----VLIGATSFGSADGCESGAPAAFTRITYYRDWIK 265
            | .:..|..|||.|    :..:|    |.:|..|........||   ....:..|.||||
  Fly   215 T-LSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSG---ILMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 58/248 (23%)
Tryp_SPc 40..267 CDD:238113 60/250 (24%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/238 (24%)
Tryp_SPc 48..269 CDD:214473 53/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.