DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG33461

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:128/296 - (43%) Gaps:51/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFV----VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSS 61
            ||..:    :.||.:..:|:..|.....|.||       ::.:|.||..|..|::|:   ::|..
  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPR-------LSYKIINGTPARLGRYPW---MAFLH 60

  Fly    62 SAGSWWCGGSIIGNEW-VLTAAHCTDGAASVTIYYGATVRTSP---------EFTQVVSSSKFRQ 116
            :...:.|.||:| |:| |||:|||.:....:....|...|.:.         |.||..:.....:
  Fly    61 TPTYFLCAGSLI-NQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFK 124

  Fly   117 HESYLALTIRNDISLIQTS-SVSFSATVNKI------SLPAVSNSYSTYEGKTAVASGWGLTS-D 173
            |..|......|||.:::.. .|.::..:..|      .:..|.:..:.::     |:|||||| |
  Fly   125 HRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFK-----ATGWGLTSTD 184

  Fly   174 QATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGP----LALDG-- 232
            ..|..||.|..::|.....:.|...|....::.:: |.. .:..:.|:||||||    :.:.|  
  Fly   185 LNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQI-CAG-NDDGNLCRGDSGGPQGRYVLIFGMK 247

  Fly   233 --VLIGATSFGSADGCESGAPAAFTRITYYRDWIKE 266
              |.:|..|| :.:.|..  .:..|.:..|..|||:
  Fly   248 RFVQMGIASF-TYENCSK--VSILTDVVRYGRWIKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 63/250 (25%)
Tryp_SPc 40..267 CDD:238113 66/253 (26%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 63/250 (25%)
Tryp_SPc 42..281 CDD:238113 66/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.