DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Sp212

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:269 Identity:68/269 - (25%)
Similarity:109/269 - (40%) Gaps:42/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PRDRVST------PSITGRITNGKDAVAGQFPYQVGLSFSS-SAGSWWCGGSIIGNEWVLTAAHC 84
            ||.::|:      .|.|..|..|.:...||:|:...:.... .|.::.|.||:|.:..|::||||
  Fly   258 PRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHC 322

  Fly    85 TDGAASVTIYYGATVRTSPEF----TQVVSSSKFRQHESYLALTIRN-DISLIQTSSVSFSATVN 144
            ........:..|.......::    .::.:..:...|..|...:..: ||:||   ::....|.|
  Fly   323 VHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALI---TIERPVTFN 384

  Fly   145 KISLP------AVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQY---VDLTIISNSKCQETFG 200
            .|..|      ..|.:.||    |...:|||...|     |...||   |:..|.|.:.|..|:.
  Fly   385 DIIAPICMWTVEASRTVST----TGFIAGWGRDED-----SSRTQYPRVVEAEIASPTVCASTWR 440

  Fly   201 SLIVTSRVLCVDTTNKASTCQGDSGGPL--------ALDGVLIGATSFGSADGCESGAPAAFTRI 257
            ..:||.|.||....:.:..|.|||||.|        .|.|: :.|...|.|..|:......:..:
  Fly   441 GTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGI-VSAGERGPAGTCQLNQYVLYCDL 504

  Fly   258 TYYRDWIKE 266
            :.:.:||.|
  Fly   505 SKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 60/247 (24%)
Tryp_SPc 40..267 CDD:238113 63/250 (25%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 63/250 (25%)
Tryp_SPc 277..511 CDD:214473 60/246 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.