DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Tpsg1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:261 Identity:81/261 - (31%)
Similarity:114/261 - (43%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAAS 90
            ||  :||...  .||..|..|.||.:|:|..|....   ...||||::..|||||||||..|:.:
Mouse    77 HP--QVSNSG--SRIVGGHAAPAGTWPWQASLRLHK---VHVCGGSLLSPEWVLTAAHCFSGSVN 134

  Fly    91 VTIYY----GATVRTSPEFTQVVSSSKFRQHESYLALT-------IRNDISLIQTSS-VSFSATV 143
            .:.|.    ..||..||.|:.|         :..:..|       ...||:|:|.|| |:.|:.|
Mouse   135 SSDYQVHLGELTVTLSPHFSTV---------KRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQV 190

  Fly   144 NKISLPAVSNSYSTYEGKTAVASGWGLTSD-QATAVSRDLQYVDLTIISNSKCQETF----GSLI 203
            ..:.||..|..:  |.|.....:|||.|.: :......:||...::::....|.:.:    ||||
Mouse   191 QPVCLPEASADF--YPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLI 253

  Fly   204 VTSRVLCVDTTNKASTCQGDSGGPLALDGV----LIGATSFGSADGC-ESGAPAAFTRITYYRDW 263
            ... :||  .......||.||||||.....    ..|..|:|  :|| ....|..:.|:|.|.:|
Mouse   254 QPD-MLC--ARGPGDACQDDSGGPLVCQVAGTWQQAGVVSWG--EGCGRPDRPGVYARVTAYVNW 313

  Fly   264 I 264
            |
Mouse   314 I 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/246 (30%)
Tryp_SPc 40..267 CDD:238113 76/247 (31%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.