DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Klkb1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:246 Identity:75/246 - (30%)
Similarity:123/246 - (50%) Gaps:18/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIY--Y 95
            |..|..||..|.::..|::|:||.|.....:.:..|||||||.:|:||||||.||.....::  |
  Rat   384 TTKINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIY 448

  Fly    96 GATVRTSPEFTQVVSSSKFRQ---HESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYS 156
            |..:..| |.|.....|..::   |:.|.......||:||:..: ::::.....|.||:.:::.:
  Rat   449 GGILNLS-EITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNT 512

  Fly   157 TYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVD-TTNKASTC 220
            .|  .....:|||.|.::. .....||...:.::.|.:||:.:...::|.:::|.. .......|
  Rat   513 IY--TNCWVTGWGYTKERG-ETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDAC 574

  Fly   221 QGDSGGPLALD----GVLIGATSFGSADGC-ESGAPAAFTRITYYRDWIKE 266
            :|||||||...    ..|:|.||:|  :|| ....|..:|::..|.|||.|
  Rat   575 KGDSGGPLVCKHSGRWQLVGITSWG--EGCARKEQPGVYTKVAEYIDWILE 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/236 (30%)
Tryp_SPc 40..267 CDD:238113 72/239 (30%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 70/236 (30%)
Tryp_SPc 391..621 CDD:238113 69/235 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.