DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG30323

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:265 Identity:52/265 - (19%)
Similarity:80/265 - (30%) Gaps:106/265 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISL 131
            :|.||::...||:|:..|              |.|.||.|....|:             |.::.:
  Fly    53 FCAGSLLSAWWVVTSGCC--------------VSTRPESTPNQPSN-------------RKNLRV 90

  Fly   132 IQTSSVSFSATVNKISLPAVSNSY---------STYEGKTAVA---------------------- 165
            :       ..|..::..|:..|.|         |...|.|.:|                      
  Fly    91 V-------VFTPKRLKKPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKEL 148

  Fly   166 --------SGWG------------------------LTSDQATAVSRDLQYVDLTIISNSKCQET 198
                    .|||                        :|..|....|.:|..:....||..:|:..
  Fly   149 NSTWLCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPD 213

  Fly   199 FGSLIVTSRVLCVDT-TNKASTCQGDSGGPLALDGVLIGATSFGSADGCESGAPAAFTRITYYRD 262
                  .||.||:.: |.:.:.||.|.|.||..|..|.|...  ....|:......:|.|...|.
  Fly   214 ------CSRCLCMTSYTGRGNMCQQDLGSPLFCDHFLYGVAR--RVHTCDDEGFMFYTNIYQNRK 270

  Fly   263 WIKET 267
            :|::|
  Fly   271 FIEDT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 50/260 (19%)
Tryp_SPc 40..267 CDD:238113 51/263 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 51/263 (19%)
Tryp_SPc 45..272 CDD:214473 50/260 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.