DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG30187

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:114/258 - (44%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTI 93
            |::...:|..:||.|.:|.   |...|.::...:...:.|||::|...:|||||||.......::
  Fly    25 DQICGINIALKITGGHNAA---FQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSV 86

  Fly    94 YYGATVRTSPE-----FTQVVSSSKFRQHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVS 152
            ..||..::.|.     .|.||.|| |....||     .|||.|::.|| |.|:|.:..|.: .::
  Fly    87 SLGAYNKSDPADRKDVITAVVHSS-FDVRASY-----ENDIGLLKLSSDVIFNALIRPICI-VLN 144

  Fly   153 NSYSTY--EGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTN 215
            .|.:.:  ..:|..|.|||......|  |..||.:.|..:...:|.... |:..:.:.:|....:
  Fly   145 KSMANHMRNMRTFKAFGWGTLRGNKT--SDILQTIILNHLDREECYMEL-SVYPSEKQICAGVPS 206

  Fly   216 KASTCQGDSGGPLALD---------GVLIGATSFG--SADGCESGAPAAFTRITYYRDWIKET 267
             ..||.|||||||..|         .|..|..|.|  |.||     ...:|.:..:.||||.|
  Fly   207 -GDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDG-----QGVYTDLMSFADWIKMT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/243 (29%)
Tryp_SPc 40..267 CDD:238113 74/245 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 71/243 (29%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.