DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG30098

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:223 Identity:58/223 - (26%)
Similarity:96/223 - (43%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGA--TVRTSPEFTQVVSSSKFRQHESYLALTIRN-DI 129
            ||||:|...:||||||||....::.:..|.  :.||:...|:........:|::|  :..|| ||
  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNY--IDFRNHDI 122

  Fly   130 SLIQTS-SVSFSATVNKI------SLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDL 187
            ::::.. .|.:.|.:..|      .|.:::||...:     ..:|||..: ....:...||.:.|
  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNF-----TLTGWGQMA-HYYKMPTTLQEMSL 181

  Fly   188 TIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLI-----------GATS-- 239
            ..:.|..|.      :.:..:.|.:....|  |.|||||||   |.|:           |.|:  
  Fly   182 RRVRNEYCG------VPSLSICCWNPVQYA--CFGDSGGPL---GSLVKYGHKTIYVQFGVTNSV 235

  Fly   240 FGSADGCESGAPAAFTRITYYRDWIKET 267
            .|:.||..|     :..:..|..|:.:|
  Fly   236 TGNCDGYSS-----YLDLMSYMPWLYQT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 56/218 (26%)
Tryp_SPc 40..267 CDD:238113 57/221 (26%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 56/217 (26%)
Tryp_SPc 37..258 CDD:238113 57/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.