DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Cela2a

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:283 Identity:92/283 - (32%)
Similarity:136/283 - (48%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLVLALASASAGLL----PNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            ::..|.|::..||.|    |.....|.         ..|:..|::|....:|:||.|.:.|| |.
  Rat     1 MIRTLLLSALVAGALSCGYPTYEVQHD---------VSRVVGGQEASPNSWPWQVSLQYLSS-GK 55

  Fly    66 W--WCGGSIIGNEWVLTAAHCTDGAASVTIYYGA-TVRTSPEFTQVVSSSKFRQHESYLA--LTI 125
            |  .||||::.|.||||||||...:.:..:..|. ::.||...:..|..||...||.:.|  |:.
  Rat    56 WHHTCGGSLVANNWVLTAAHCISNSRTYRVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQKLSN 120

  Fly   126 RNDISLIQTSS-VSFSATVNKISLP----AVSNSYSTYEGKTAVASGWGLTSDQATAVSRD-LQY 184
            .|||:|::.:| |:.::.:....||    .:.|:|..|      .:|||..  |....:.| ||.
  Rat   121 GNDIALVKLASPVALTSKIQTACLPPAGTILPNNYPCY------VTGWGRL--QTNGATPDVLQQ 177

  Fly   185 VDLTIISNSKCQET--FGSLIVTSRVLCVDTTNKASTCQGDSGGPL---ALDG--VLIGATSFGS 242
            ..|.::..:.|...  :||.:.|:.| |.......|:|.|||||||   |.:|  .:.|..||||
  Rat   178 GRLLVVDYATCSSASWWGSSVKTNMV-CAGGDGVTSSCNGDSGGPLNCQASNGQWQVHGIVSFGS 241

  Fly   243 ADGCE-SGAPAAFTRITYYRDWI 264
            ..||. ...|:.|||::.|.|||
  Rat   242 TLGCNYPRKPSVFTRVSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 83/243 (34%)
Tryp_SPc 40..267 CDD:238113 84/244 (34%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 83/243 (34%)
Tryp_SPc 31..267 CDD:238113 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.