DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Cela1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:248 Identity:79/248 - (31%)
Similarity:119/248 - (47%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW--CGGSIIGNEWVLTAAHCTDGAASVTIYYG 96
            |....|:..|.:|....:|.|:.|.: .|.|||:  |||::|...||:|||||.....:..:..|
  Rat    21 PETNARVVGGAEARRNSWPSQISLQY-LSGGSWYHTCGGTLIRRNWVMTAAHCVSSQMTFRVVVG 84

  Fly    97 ATVRTSPEFT-QVVSSSKFRQHESYLALTIR--NDISLIQ-TSSVSFSATVNKISLP----AVSN 153
            ....:..:.| |.||..|...|.::.:..:.  .||:|:: ..||:.:..|....||    .::|
  Rat    85 DHNLSQNDGTEQYVSVQKIVVHPNWNSNNVAAGYDIALLRLAQSVTLNNYVQLAVLPQEGTILAN 149

  Fly   154 SYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQET--FGSLIVTSRVLCVDTTNK 216
            :...|      .:|||.|.... .:|:.||...|..:..|.|..:  :||.:.|:.| |......
  Rat   150 NNPCY------ITGWGRTRTNG-QLSQTLQQAYLPSVDYSICSSSSYWGSTVKTTMV-CAGGDGV 206

  Fly   217 ASTCQGDSGGPL--ALDG--VLIGATSFGSADGCE-SGAPAAFTRITYYRDWI 264
            .|.|||||||||  .::|  .:.|.|||.|:.||. |..|..|||::.|..|:
  Rat   207 RSGCQGDSGGPLHCLVNGQYSVHGVTSFVSSMGCNVSRKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 77/241 (32%)
Tryp_SPc 40..267 CDD:238113 77/242 (32%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 77/240 (32%)
Tryp_SPc 27..262 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.