DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Cela3a

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:290 Identity:84/290 - (28%)
Similarity:125/290 - (43%) Gaps:46/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW--WC 68
            :|::||||...      .|.|      .||  .|:.||::||...:|:||.|.: ...||:  .|
Mouse     8 LLLVALASGCG------QPSH------NPS--SRVVNGEEAVPHSWPWQVSLQY-EMGGSFHHTC 57

  Fly    69 GGSIIGNEWVLTAAHCTDGAASVTIYYGA---TVRTSPEFTQVVSSSKFRQHESYLALTIR--ND 128
            |||:|..:|||||.||.....:..:..|.   .|....|....:::.:...|..:.:..:.  |:
Mouse    58 GGSLITPDWVLTAGHCIMPYLNYRVVLGEHEHGVEEGSEQVIPINAGELFVHPKWNSECVNCGNN 122

  Fly   129 ISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISN 192
            |:|::.| |......|....||.......  .|.....||||..|......:: ||...|.::..
Mouse   123 IALVKLSRSAQLGDAVQLACLPPAGEILP--NGAPCYISGWGRLSTNGPLPTK-LQQALLPVVDY 184

  Fly   193 SKCQ--ETFGSLI----------VTSRVLCVDT--TNKASTCQGDSGGPL---ALDGV--LIGAT 238
            ..|.  :.:|..:          :.:..|..||  ....|..||||||||   |.:|.  :.|..
Mouse   185 EHCSRWDWWGHYVKRTMVCAGGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQVHGIA 249

  Fly   239 SFGSADGCES-GAPAAFTRITYYRDWIKET 267
            ||.|..||.: ..|..|||::.:.|||:||
Mouse   250 SFVSPSGCNTLKKPTMFTRVSAFIDWIEET 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/252 (28%)
Tryp_SPc 40..267 CDD:238113 72/254 (28%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 71/252 (28%)
Tryp_SPc 28..279 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.