DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Prss27

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:297 Identity:80/297 - (26%)
Similarity:131/297 - (44%) Gaps:64/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCG 69
            ::|.|.|.|.:.|.....|..||:       :..|:..|::|:.|::|:||.:..:   |..:||
Mouse    10 LLLPLLLRSGTEGARTLRACGHPK-------MFNRMVGGENALEGEWPWQVSIQRN---GIHFCG 64

  Fly    70 GSIIGNEWVLTAAHCTDGAASVTIY---YGA----------------TVRTSPEFTQVVSSSKFR 115
            ||:|...||||||||....:.::||   .||                .|:::|::..:.||:   
Mouse    65 GSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQPGPHALYVPVKQVKSNPQYQGMASSA--- 126

  Fly   116 QHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVS 179
                        |::|::... |:|:..:..:.||..|..:.:  |.....:|||..|:|....:
Mouse   127 ------------DVALVELQGPVTFTNYILPVCLPDPSVIFES--GMNCWVTGWGSPSEQDRLPN 177

  Fly   180 -RDLQYVDLTIISNSKC--------QETFGSLIVTSRVLCVD-TTNKASTCQGDSGGPLAL---- 230
             |.||.:.:.||...||        :..|....:...:||.. ...|...|:|||||||..    
Mouse   178 PRVLQKLAVPIIDTPKCNLLYNKDVESDFQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQ 242

  Fly   231 DGVLIGATSFGSADGC-ESGAPAAFTRITYYRDWIKE 266
            ..|..|..|:|  :|| ....|..:.|:|.:..||.:
Mouse   243 SWVQAGVISWG--EGCARRNRPGVYIRVTSHHKWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/259 (27%)
Tryp_SPc 40..267 CDD:238113 71/262 (27%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 70/259 (27%)
Tryp_SPc 39..278 CDD:238113 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.