DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and T22A3.6

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:138 Identity:32/138 - (23%)
Similarity:48/138 - (34%) Gaps:44/138 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FPYQVGLSFSSSAGSWWCGGSIIGNE--------WVLTAAHCTDGAASVTI-----YYGA----- 97
            |.||.|:...          :||.:|        |....:.|.|..|:..:     |:|:     
 Worm   285 FTYQQGILLD----------AIIEDELTISGCTFWRRCFSSCQDDLATCWLKSQKGYFGSKATSV 339

  Fly    98 --------TVRTSPEFTQV-VSSSKFRQHESYLALTIRNDISLIQTSSVSFSAT------VNKIS 147
                    |..||...:.| |:|:....:..|..| :..|.|...|.|..|..|      :|:.:
 Worm   340 SGKQCIPWTQATSEILSMVKVNSTSSGVYHMYHRL-LFEDPSQFFTESRLFMNTEASCMLLNRRN 403

  Fly   148 LPAVSNSY 155
            ...|.|||
 Worm   404 SVEVKNSY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 32/138 (23%)
Tryp_SPc 40..267 CDD:238113 32/138 (23%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.