DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and try-4

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:299 Identity:70/299 - (23%)
Similarity:99/299 - (33%) Gaps:113/299 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAH---CTDGA------------ASVTIY------ 94
            ||:.|..:..   |....|||||....::||||   .|.|:            .:.:||      
 Worm    58 FPWAVSFTVD---GVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFL 119

  Fly    95 -------YGAT---------------------------VRTSPEFTQVVSSSKFRQHESYLALTI 125
                   ||.|                           |....||   .||:..:.|        
 Worm   120 RDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEF---ASSNCLKGH-------- 173

  Fly   126 RNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWG----------LTSDQATAVS 179
              |.::::... :.||..|..|.||. .|.|.|   |:....|||          |..:....:.
 Worm   174 --DWAIVEVEKRIHFSENVRPICLPR-PNMYYT---KSLAVPGWGRSYIFNESGPLIHEIPMRID 232

  Fly   180 RDLQYVDLTIISNSKCQETFGSLIVTSR--VLCVDTTNKAS-----TCQGDSGGPLAL------D 231
            ||             |:..:...:....  .:|..:.|.::     ||.|||||.|..      .
 Worm   233 RD-------------CKRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGR 284

  Fly   232 GVLIGATSFGSADGCESGAPAAFTRITYYRDWIKETSGI 270
            ..||..||||:. ||.|...|.|||:..|.:.|...:|:
 Worm   285 AFLIAITSFGTR-GCPSNMLARFTRVDMYLNLICNYTGV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/291 (23%)
Tryp_SPc 40..267 CDD:238113 69/294 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 69/293 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.