DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and try-3

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:261 Identity:74/261 - (28%)
Similarity:116/261 - (44%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGAT 98
            |..:.||..|.....|.......:|:..:.....||.::|.:.|::|||||.....:.:..|...
 Worm    32 PIFSFRIIGGNSIDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVRE 96

  Fly    99 VRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTSSVSFSATVNKISLPAV----SNSYSTYE 159
            .:.:.|.:..|..:..  |..|...|..|||:|::.||     .::|:.:..|    .:|....:
 Worm    97 PKNNRERSFSVKEAYI--HSGYNNQTADNDIALLRISS-----DLSKLGIKPVCLVHDDSKLLKQ 154

  Fly   160 GKTAVASGWGLTSDQATA------VSRDLQYVDLTIISNSKCQET--FGSLI---VTSRVLCVDT 213
            .|..|..|:|||..:.::      .|:.||...:.|||:..|.:|  |.||:   :|...:|.. 
 Worm   155 YKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAG- 218

  Fly   214 TNKASTCQGDSGGPLAL-----DGVLIGATSFGSADGC-----ESGAPAAFTRITYYRDWIKETS 268
            .....|..|||||||.:     :.|.||.||:| |||.     :...|..:|||:.|..||:...
 Worm   219 AYLHGTAPGDSGGPLLIHKSNGEYVQIGITSYG-ADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 282

  Fly   269 G 269
            |
 Worm   283 G 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 70/249 (28%)
Tryp_SPc 40..267 CDD:238113 71/251 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.