DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and Tpsb2

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:290 Identity:87/290 - (30%)
Similarity:135/290 - (46%) Gaps:49/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65
            :|..::|:.||:     ||.::....||.......|.|    |.:|...::|:||.|.|..:...
Mouse     2 LKRLLLLLWALS-----LLASLVYSAPRPANQRVGIVG----GHEASESKWPWQVSLRFKLNYWI 57

  Fly    66 WWCGGSIIGNEWVLTAAHCTD-----------GAASVTIYYGATVRTSPEFTQVVSSSKFRQHES 119
            .:||||:|..:||||||||..           ......:|||         .|::|.::...|..
Mouse    58 HFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYG---------DQLLSLNRIVVHPH 113

  Fly   120 YLALTIRNDISLIQTS-SVSFSATVNKISLPAVSNSYSTYEGKTAVASGWG-LTSDQATAVSRDL 182
            |.......|::|::.. .|:.|..::.||||..|.::.  .|.:...:||| :.:|:.......|
Mouse   114 YYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFP--PGTSCWVTGWGDIDNDEPLPPPYPL 176

  Fly   183 QYVDLTIISNSKCQETFGS--------LIVTSRVLCVDTTNKASTCQGDSGGPLA--LDGVLI-- 235
            :.|.:.|:.||.|...:.:        .||...:||...|.:.| |||||||||.  :.|..:  
Mouse   177 KQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDS-CQGDSGGPLVCKVKGTWLQA 240

  Fly   236 GATSFGSADGC-ESGAPAAFTRITYYRDWI 264
            |..|:|  :|| :...|..:||:|||.|||
Mouse   241 GVVSWG--EGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 75/250 (30%)
Tryp_SPc 40..267 CDD:238113 77/251 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.