DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CTRB1

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:272 Identity:88/272 - (32%)
Similarity:145/272 - (53%) Gaps:25/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGL-LPNIAPVHPRDRVSTPSITG--RITNGKDAVAGQFPYQVGLSFSSSAG 64
            ::::...:|..|:.|. :|.|.||          ::|  ||.||:|||.|.:|:||  |.....|
Human     4 LWLLSCFSLVGAAFGCGVPAIHPV----------LSGLSRIVNGEDAVPGSWPWQV--SLQDKTG 56

  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDI 129
            ..:||||:|..:||:|||||....:.|.:.......:..|..||:..:|..::..:..||:.|||
Human    57 FHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDI 121

  Fly   130 SLIQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNS 193
            :|::.:: ..||.||:.:.||:..:.:..  |.....:|||.|...|......||...|.::||:
Human   122 TLLKLATPARFSQTVSAVCLPSADDDFPA--GTLCATTGWGKTKYNANKTPDKLQQAALPLLSNA 184

  Fly   194 KCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL--DG--VLIGATSFGSADGCESGAPAAF 254
            :|::::|..| |..::|...:. .|:|.|||||||..  ||  .|:|..|:|| |.|.:.:|..:
Human   185 ECKKSWGRRI-TDVMICAGASG-VSSCMGDSGGPLVCQKDGAWTLVGIVSWGS-DTCSTSSPGVY 246

  Fly   255 TRITYYRDWIKE 266
            .|:|....|:::
Human   247 ARVTKLIPWVQK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 79/229 (34%)
Tryp_SPc 40..267 CDD:238113 79/232 (34%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 79/229 (34%)
Tryp_SPc 34..259 CDD:238113 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.