DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG43742

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:278 Identity:80/278 - (28%)
Similarity:129/278 - (46%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWW 67
            :.:|.|:...:|.|.||         |......||.|:.||..|:..||   :...:::|  .::
  Fly     7 LLLVAVVIYQNAFAQLL---------DENCKVKITYRVANGHTAITSQF---MAALYNNS--EFF 57

  Fly    68 CGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTS--PEFTQVVS-SSKFRQHESYLALTIRNDI 129
            ||||:|..::|||||||......||::.|...|:.  |....|:. ::|...|.::......|||
  Fly    58 CGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDI 122

  Fly   130 SLIQTS-SVSFSATVNKISL----PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTI 189
            :|::.. .|.|.|.:..|.:    ...||:.:.:     .|.|||.|  :...:|..|.::||..
  Fly   123 ALLRLEREVIFEAHIRPICIILDEDVTSNNQNNF-----TAYGWGKT--EHGNISDVLSFIDLVR 180

  Fly   190 ISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD--------GVLIGATSFGSADGC 246
            :..|.|.:...:       :|..:|: ..||:.||||||..:        .:|.|.||:|.|: |
  Fly   181 LPKSMCYQNINT-------ICAGSTS-GDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-C 236

  Fly   247 ESGAPAAFTRITYYRDWI 264
             ||....:|.:..|:.||
  Fly   237 -SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 69/240 (29%)
Tryp_SPc 40..267 CDD:238113 70/241 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 69/240 (29%)
Tryp_SPc 35..256 CDD:238113 70/241 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.