DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG43336

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:112/275 - (40%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPNIAPVHPRD-----RVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEW 77
            |||.:......|     |..:||:. |:.||..|.....|:...|  .|:.|.:.||||:|.|..
  Fly    12 LLPLLGSTQFLDMACGIRAHSPSVP-RVKNGTVASLTSSPWMAFL--HSTDGRFICGGSLITNRL 73

  Fly    78 VLTAAHCTDGAASVTIYYGATVRTSPEF---------TQVVSSSKFRQHESYLALTIRNDISLIQ 133
            |||||||......:....|...|...|.         .:.:....|| |..|..:|:..||::::
  Fly    74 VLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFR-HRHYNPMTMAYDIAILR 137

  Fly   134 T-SSVSFSATVNKISLPAVSNSYSTYEGK--TAVASGWGLTSDQATAVSRDLQYVDLTIISNSKC 195
            . ..|.::..:..|.: .:...:..|...  ....:|||.|..:..  |..|:.|||.......|
  Fly   138 LYRKVQYTDNIRPICI-VIDPRWRKYIDSLDPLTGTGWGKTESEGD--SAKLRTVDLARKHPEVC 199

  Fly   196 QETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLI-----------GATSFGSADGCESG 249
            :. :.:|.:|:...|.. ..:::.|.||||||:   |.||           |..||.:.   :..
  Fly   200 RR-YATLSLTANQFCAG-NERSNLCNGDSGGPV---GALIPYGKSKRFVQVGIASFTNT---QCV 256

  Fly   250 APAAFTRITYYRDWI 264
            ..:.||.:..|.|||
  Fly   257 MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 64/247 (26%)
Tryp_SPc 40..267 CDD:238113 65/248 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 64/247 (26%)
Tryp_SPc 40..271 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.