DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and CG42694

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:257 Identity:55/257 - (21%)
Similarity:99/257 - (38%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTI 93
            |....|.....||..:...||      .|:..|:.....|.||:|..::||:||.|.|....:.:
  Fly    25 DYCGAPISNQSITKLRQPQAG------WLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFV 83

  Fly    94 YYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTS-SVSFSATV---------NKISL 148
            ..|.:..|.......||:.....|.   ...::.||.|::.| ||.::..|         |.:.:
  Fly    84 QLGVSNATKSPHWYTVSNVVIPSHS---GKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDM 145

  Fly   149 PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDT 213
            ..:..:::|        |.|       .:.:::.|.:.|:.:|..:|:... |..||.:.:|..:
  Fly   146 VKILQNFTT--------SAW-------LSKNKNPQTIVLSQLSRDRCKLNL-SGNVTPKEICAAS 194

  Fly   214 TNKASTCQGDSGGPLA---LDG------VLIGATSF-GSADGCESGAPAAFTRITYYRDWIK 265
            ..:.::|..|||..|.   :.|      :|.|...: .....|..  ||.:..:.....||:
  Fly   195 LQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSE--PAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 51/244 (21%)
Tryp_SPc 40..267 CDD:238113 53/246 (22%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 49/230 (21%)
Tryp_SPc 46..253 CDD:214473 47/227 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.