DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and zgc:163079

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:279 Identity:77/279 - (27%)
Similarity:137/279 - (49%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLALASASAGLLPNIAP-VHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGS 71
            |..:|.|   :|.|||. :...|......:..:|..|.:|..|.:|:|..::..::. .::||||
Zfish     6 VFCVAGA---ILLNIAGCLGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATE-EFYCGGS 66

  Fly    72 IIGNEWVLTAA--HCTDGAASVTIYYGATVR--TSP-EFTQVVSSSKFRQHESYLALTIRNDISL 131
            :|...||||.|  .....|:.:.:|.|...:  ::| |.::.|  :|..:|.:|.:|.  ::::|
Zfish    67 LINKGWVLTTAKVFALMPASDIVVYLGRQTQNGSNPYEISRTV--TKIIKHPNYNSLD--SNLAL 127

  Fly   132 IQTSS-VSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATA----VSRDLQYVDLTIIS 191
            ::.|| |:||..:..:.|.|..:.:  .:|..:..:|||..:..||.    :...||.|:..|::
Zfish   128 LKLSSPVTFSDYIKPVCLAAAGSVF--VDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVN 190

  Fly   192 NSKCQETFGSLIVTSRVLCVDTTNK--ASTCQGDSGGPLAL--------DGVLIGATSFGSADGC 246
            |.:|...:|. |:|:::||....|:  .:.|.||.||||.:        .||::...       |
Zfish   191 NFECNAAYGG-IITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGY-------C 247

  Fly   247 E-SGAPAAFTRITYYRDWI 264
            . .|.|..:.|::.|.|||
Zfish   248 GLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 67/245 (27%)
Tryp_SPc 40..267 CDD:238113 69/246 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 67/245 (27%)
Tryp_SPc 36..267 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.