DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and LOC100004427

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:275 Identity:78/275 - (28%)
Similarity:131/275 - (47%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLALASASAGLLPNIAP-VHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGS 71
            |..:|.|   :|.|||. :...|......:..:|..|.:|..|.:|:|..::|.|: |.::|.||
Zfish     6 VFCVAGA---VLLNIAGCLGQSDVCGRAPLNTKIVGGLNATEGSWPWQASINFKST-GQFFCSGS 66

  Fly    72 IIGNEWVLTAAHCTD--GAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQ- 133
            :|...||||||.|..  ..:.|.||.|.....        .|:.:....:.:.:::..||:|:| 
Zfish    67 LISERWVLTAASCFQRINVSDVVIYLGRLTTN--------GSNPYEIPRTVIQVSVTEDIALVQL 123

  Fly   134 TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQET 198
            :|||:|:..:..:.|.|..:.:  .:|..:..:|||.||.....:|..|:.|:..|::|.:|...
Zfish   124 SSSVTFTDYIRPVCLAAAGSVF--VDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNI 186

  Fly   199 FGSLIVTS--RVLC---VDTTNKASTCQGDSGGPLAL--------DGVLIGATSFGSADGCESGA 250
            .|   :|:  .|:|   |:.|.|| .|..|.|.||..        .||:: .|..|     ::|.
Zfish   187 NG---ITNLDNVICAGFVNETGKA-PCWEDFGSPLVTRQGSQWIQSGVVV-FTFCG-----QNGF 241

  Fly   251 PAAFTRITYYRDWIK 265
            |..:.|::.|.:||:
Zfish   242 PTLYARVSEYEEWIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 68/240 (28%)
Tryp_SPc 40..267 CDD:238113 70/242 (29%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 68/240 (28%)
Tryp_SPc 36..257 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.