DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip7 and zgc:171592

DIOPT Version :9

Sequence 1:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001104713.2 Gene:zgc:171592 / 100003031 ZFINID:ZDB-GENE-080220-23 Length:260 Species:Danio rerio


Alignment Length:278 Identity:94/278 - (33%)
Similarity:148/278 - (53%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLVLALASASAGL-LPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGSW 66
            :|.:...||.:::.|. :|.|.|         ..|..||.||::|::|.:|:||.|...:  |..
Zfish     2 IFTITCFALVASALGCGVPAIKP---------QIIGSRIVNGQNAISGSWPWQVSLQLPN--GVH 55

  Fly    67 WCGGSIIGNEWVLTAAHCTDGAASVTIYYGATV------RTSPEFTQVVSSSKFRQHESYLALTI 125
            :||||:|...||||||||     ||.:.|...|      .::.|..||...||...|..:...|:
Zfish    56 FCGGSLINRNWVLTAAHC-----SVVVGYHRVVLGEHDRGSNAEPIQVKLVSKVVTHPLFSRTTL 115

  Fly   126 RNDISLIQTSS-VSFSATVNKISL-PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLT 188
            .|||:|::.:| |:.:|.|:.:.| |:..|..|   |.....:|||.|:  :|:..|.||...:.
Zfish   116 NNDIALLKLASPVTLTARVSPVCLAPSAINIQS---GTRCFTTGWGRTA--STSSPRILQQTSVP 175

  Fly   189 IISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD--GV--LIGATSFGSADGCESG 249
            ::|::.|::.:|...||..::|...:. :|:|:|||||||..:  ||  |:|:.|:| .|.|.:.
Zfish   176 LVSHADCRQIWGRNRVTDAMICAGGSG-SSSCRGDSGGPLVCERSGVWTLVGSVSWG-LDTCNTR 238

  Fly   250 APAAFTRITYYRDWIKET 267
            .|..:.||:..|.||..|
Zfish   239 FPGVYARISQQRSWINTT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 83/236 (35%)
Tryp_SPc 40..267 CDD:238113 84/238 (35%)
zgc:171592NP_001104713.2 Tryp_SPc 31..256 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.