DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Ctrc

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:286 Identity:82/286 - (28%)
Similarity:122/286 - (42%) Gaps:56/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSW--WCGG 70
            :||.|:...|      |..|      |::..|:..|..|..|.:|:||.|.:... .:|  .|||
Mouse    10 ILACASSCGD------PTFP------PNLSARVVGGEDAVPNSWPWQVSLQYLRD-DTWRHTCGG 61

  Fly    71 SIIANTWVLTAAHCTKGASSVTI---YYGSTVRTSAKLKKKVSSSKFVQ------HAGYNAATLR 126
            |:|..:.|||||||.....:..:   .|..||...       ..|.:.:      |..:|...|.
Mouse    62 SLITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDE-------EGSVYAEVDTIYVHEKWNRLLLW 119

  Fly   127 NDISLIK-TPSVTFTVSINKIALP----AIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQ 186
            |||::|| ...|..:.:|....:|    .:...|..|      .:||||...:. .:|..||...
Mouse   120 NDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYPCY------VTGWGRLWTNG-PIAEVLQQGL 177

  Fly   187 FQVITNAVCQK-TFGSSVVTSGVICVESINKKSTCQGDSGGPLALNN--------RLIGVTSFVS 242
            ..::.:..|.: .:....|...::|.......|.|.|||||||   |        ::.|:.||.|
Mouse   178 QPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPL---NCPVEDGLWQVHGIVSFGS 239

  Fly   243 SKGCEK-NAPAGFTRVTSYLDWIKNQ 267
            |:||.. ..|..||||::|:||||.:
Mouse   240 SRGCNTYKKPVVFTRVSAYIDWIKEK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 72/250 (29%)
Tryp_SPc 40..267 CDD:238113 74/252 (29%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 72/250 (29%)
Tryp_SPc 30..265 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.