DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and C1S

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:246 Identity:79/246 - (32%)
Similarity:114/246 - (46%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGST-VRTS 102
            ||..|:.|....||:||...      :.|.||::|...|||||||..:|....|:|.||| |:||
Human   437 RIIGGSDADIKNFPWQVFFD------NPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQTS 495

  Fly   103 AKLKKKVSSSKFV-QHAGY-------NAATLRNDISLI--KTPSVTFTVSINKIALPAIASSYST 157
            ...|.|:.:.:.| .|.|:       ......|||:|:  |.| |....:::.|.||..:|.|:.
Human   496 RLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDP-VKMGPTVSPICLPGTSSDYNL 559

  Fly   158 YAGQTAVASGWGRTSDSSIAV---ATNLQYAQFQVITNAVCQKTFGSS---VVTSGVICVESINK 216
            ..|...:.||||||.....||   |..|..|..:.......:|....:   |.|..:||......
Human   560 MDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKG 624

  Fly   217 KSTCQGDSGGPLAL---NNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            ..:|:|||||..|:   |::.....:.:.|.|.:......:|||.:|:|||
Human   625 MDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 77/244 (32%)
Tryp_SPc 40..267 CDD:238113 78/245 (32%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037
Tryp_SPc 438..678 CDD:238113 78/245 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.