DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Prss22

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:285 Identity:78/285 - (27%)
Similarity:131/285 - (45%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLVLAI-----ATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSA 63
            |::|:|.:     |.:||..:|    |.|  ....|....||..|..:...|:|:.|.: .|:  
Mouse    73 FSILILLVLLTSTAPISAATIR----VSP--DCGKPQQLNRIVGGEDSMDAQWPWIVSI-LKN-- 128

  Fly    64 GSWWCGGSIIANTWVLTAAHCTKG----ASSVTIYYGS-TVRTSAKLKKKVSSSKFVQHAGYN-A 122
            ||..|.||::.|.||:|||||.|.    .|..::..|: .:.:.....:||..:..:.|..|: .
Mouse   129 GSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWK 193

  Fly   123 ATLRNDISLIKTP-SVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDS-SIAVATNLQYA 185
            .....||:|::.. |:.|:..|..|.||  .||...........:|||...|. .:.....||..
Mouse   194 EGTHADIALVRLEHSIQFSERILPICLP--DSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKL 256

  Fly   186 QFQVITNAVCQKTF----GSSVVTSGVICVESI-NKKSTCQGDSGGPLAL----NNRLIGVTSFV 241
            :..:|.:.:|:..:    |...:|.|::|...: .::..|.|||||||..    :..|.|:.|: 
Mouse   257 KVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISW- 320

  Fly   242 SSKGC-EKNAPAGFTRVTSYLDWIK 265
             .:|| |:|.|..:|.:.::..|::
Mouse   321 -GEGCAERNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 67/242 (28%)
Tryp_SPc 40..267 CDD:238113 67/244 (27%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.