DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Cela3b

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_080695.1 Gene:Cela3b / 67868 MGIID:1915118 Length:269 Species:Mus musculus


Alignment Length:278 Identity:89/278 - (32%)
Similarity:137/278 - (49%) Gaps:38/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSW--W 67
            ::|::|:|:....      |.|...|        |:.||.:|..:.:|:||.|.::.. ||:  .
Mouse     7 SLLLVALASGCGQ------PSHNPSS--------RVVNGEEAVPHSWPWQVSLQYEKD-GSFHHT 56

  Fly    68 CGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKV----SSSKFVQHAGYNA--ATLR 126
            ||||:|...|||||.||...:.:..:..|...|...:.:::|    :...|| |..:|:  .:..
Mouse    57 CGGSLITPDWVLTAGHCISTSRTYQVVLGEHERGVEEGQEQVIPINAGDLFV-HPKWNSMCVSCG 120

  Fly   127 NDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVI 190
            |||:|:| :.|.....::....||........  |.....|||||.|.:. .:...||.|...|:
Mouse   121 NDIALVKLSRSAQLGDAVQLACLPPAGEILPN--GAPCYISGWGRLSTNG-PLPDKLQQALLPVV 182

  Fly   191 TNAVCQK--TFGSSVVTSGVICVESINKKSTCQGDSGGPL---ALNN--RLIGVTSFVSSKGCEK 248
            ....|.:  .:|.||.|: ::|... :.:|.|.|||||||   |.|.  ::.||||||||.||..
Mouse   183 DYEHCSRWNWWGLSVKTT-MVCAGG-DIQSGCNGDSGGPLNCPADNGTWQVHGVTSFVSSLGCNT 245

  Fly   249 -NAPAGFTRVTSYLDWIK 265
             ..|..||||::::|||:
Mouse   246 LRKPTVFTRVSAFIDWIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 81/241 (34%)
Tryp_SPc 40..267 CDD:238113 82/243 (34%)
Cela3bNP_080695.1 Tryp_SPc 27..262 CDD:214473 81/241 (34%)
Tryp_SPc 28..265 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.