DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and f9b

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:284 Identity:79/284 - (27%)
Similarity:128/284 - (45%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DILRQDTPVHPRDS----SAVPSIDG---------RITNGNKAAANQFPYQVGLSFKSSAGSWWC 68
            |:...::...||:|    |:.|.:..         ||..|::|...:.|:||....|.:. ..:|
Zfish   220 DLSEMNSTSTPRNSLQNVSSSPILTNINNTTNNKYRIVGGDEAIPGEIPWQVVFLEKVNK-IVFC 283

  Fly    69 GGSIIANTWVLTAAHCTKG-ASSVTIYYGSTVRTSAKLKKKVSS---SKFVQHAGYNA--ATLRN 127
            |||:::..||:|||||.:| ..|..|..|.  ...:|::...|.   .::..|..||:  :...:
Zfish   284 GGSLLSEEWVITAAHCVEGKQGSFFIRVGE--HDVSKMEGTESDHGIEEYHIHPRYNSQRSLYNH 346

  Fly   128 DISL--IKTPSVTFTVSINKIALPAIASSYS-----TYAGQTAVASGWGRTSDSSIAVATNLQYA 185
            ||:|  :|.|.:.|     ..|:|....|..     ..:.:.::.|||||.....|. :..||..
Zfish   347 DIALLKLKKPVILF-----DYAVPICLGSKDFTENLLQSAENSLVSGWGRLRYGGIE-SNVLQKV 405

  Fly   186 QFQVITNAVCQKTFGSSV--VTSGVICV-ESINKKSTCQGDSGGPLALNNR----LIGVTSFVSS 243
            :...:....|:   |||.  ::..:.|. .|..:|..||||||||.|...:    |.|:.|:  .
Zfish   406 ELPYVDRIKCK---GSSTDSISRFMFCAGYSTVRKDACQGDSGGPHATRYKDTWFLTGIVSW--G 465

  Fly   244 KGCEKNAPAG-FTRVTSYLDWIKN 266
            :.|.|....| :||::.|:.||.|
Zfish   466 EECAKEGKYGIYTRISKYMAWITN 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 70/245 (29%)
Tryp_SPc 40..267 CDD:238113 72/248 (29%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342
Tryp_SPc 255..487 CDD:214473 70/245 (29%)
Tryp_SPc 256..490 CDD:238113 72/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.