DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Ctrb1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:278 Identity:85/278 - (30%)
Similarity:136/278 - (48%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLVLAIATVSADILRQDTPVHPRDSSAVPSID------GRITNGNKAAANQFPYQVGLSFKSS 62
            |..||...|.|.|..           ...||:|.      .||.||..|....:|:||  |.:..
Mouse     3 FLWLVSCFALVGATF-----------GCGVPAIQPVLTGLSRIVNGEDAIPGSWPWQV--SLQDR 54

  Fly    63 AGSWWCGGSIIANTWVLTAAHCTKGASSVTIY----YGSTVRTSAKLKKKVSSSKFVQHAGYNAA 123
            .|..:||||:|:..||:|||||....:.|.:.    .||.......||    .::..::..:|:.
Mouse    55 TGFHFCGGSLISENWVVTAAHCGVKTTDVVVAGEFDQGSDEENVQVLK----IAQVFKNPKFNSF 115

  Fly   124 TLRNDISLIK--TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQ 186
            |:||||:|:|  ||: .|:.:::.:.||.:...:.  ||.....:|||:|..:::.....||.|.
Mouse   116 TVRNDITLLKLATPA-QFSETVSAVCLPTVDDDFP--AGTLCATTGWGKTKYNALKTPDKLQQAA 177

  Fly   187 FQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNN----RLIGVTSFVSSKGCE 247
            ..:::.|.|::::||. :|..:||. ..:..|:|.|||||||....    .|.|:.|: .|..|.
Mouse   178 LPIVSEAKCKESWGSK-ITDVMICA-GASGVSSCMGDSGGPLVCQKDGVWTLAGIVSW-GSGFCS 239

  Fly   248 KNAPAGFTRVTSYLDWIK 265
            .:.||.:.|||:.:.|::
Mouse   240 TSTPAVYARVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 75/234 (32%)
Tryp_SPc 40..267 CDD:238113 75/236 (32%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 75/234 (32%)
Tryp_SPc 34..259 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.