DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG18754

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:107/269 - (39%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCT 85
            |.|||. ||..|           ..|..|::|:.|.|.:::..       |:|  .:|||||||.
  Fly    99 QTTPVF-RDRGA-----------ENAELNEYPWMVLLLYENRL-------SLI--RYVLTAAHCV 142

  Fly    86 KGA---------SSVTIYYGSTVRTSAKLK---KKVSSSKFVQHAGYNAA--TLRNDISLIKTP- 135
            .|.         .||.:...:|...:::.:   ..|...:...|.|:.::  |.||||:|::.. 
  Fly   143 IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQF 207

  Fly   136 SVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFG 200
            .|.:|..|..|.|  :.:.:........: |||..|..|...:.:.::..     ..|.|...: 
  Fly   208 PVRYTKKIQPICL--LDAEFPLQDLNLQI-SGWDPTKSSQTLITSTVKER-----NPADCLNRY- 263

  Fly   201 SSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKG--------C-EKNAPAGFTR 256
            .|..::..:|.....|..||.|.||.|: :.....||..||...|        | ....|..:|:
  Fly   264 PSFRSASQVCAGGQRKGDTCAGISGSPV-MGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTK 327

  Fly   257 VTSYLDWIK 265
            :..:.:|||
  Fly   328 IGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 56/248 (23%)
Tryp_SPc 40..267 CDD:238113 59/250 (24%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/259 (23%)
Tryp_SPc 108..335 CDD:214473 57/256 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.