DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG34171

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:286 Identity:73/286 - (25%)
Similarity:107/286 - (37%) Gaps:56/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGR---ITNGNKAAANQFPYQVGLSFKSS 62
            :|:..||...|.|:.  |.....|.:...||.:.|:..|   .|.|:    |.|           
  Fly     9 LKIALVLPKNITTIK--INHYHEPTYSHLSSYLVSLRTRKYIHTPGD----NHF----------- 56

  Fly    63 AGSWWCGGSIIANTWVLTAAHCTKGASSVTIY-YGSTVRTSAKLKKKVSSSKFVQ-------HAG 119
                 |.|.|:.|..|||:|||....:.|.:. ....|...|.|.|...|.:||.       |..
  Fly    57 -----CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPY 116

  Fly   120 YNAATLRNDISLIKTPSVTFTVSINKIAL-PAIASSYSTYAGQTAVASG--WG----RTSDSSIA 177
            |: ....|||::||....   |.::...| |.:..:.|...|......|  :|    |.......
  Fly   117 YH-RNQHNDIAIIKLKRY---VKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSM 177

  Fly   178 VATNLQYAQFQVITNAVCQKTFGSSVV----TSGVICVESINKKSTCQGDSGGPLALNNRLIGVT 238
            :..|::...|.     .|.|...|.:.    ...:|||:| .:|..|..|.||||..:.:|.|:.
  Fly   178 LLVNVELRPFD-----ECLKVKKSLMAARPENEDLICVKS-TEKQMCTTDFGGPLFCDGQLYGIA 236

  Fly   239 SFVSSKGCEKNAPAGFTRVTSYLDWI 264
              :.|..|....|..|:.|:.|..|:
  Fly   237 --LGSINCSSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 62/246 (25%)
Tryp_SPc 40..267 CDD:238113 62/244 (25%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 66/262 (25%)
Tryp_SPc 38..263 CDD:304450 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.