DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and zgc:112285

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:317 Identity:92/317 - (29%)
Similarity:138/317 - (43%) Gaps:73/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLVLAIATV---------SADILRQDTPVH---PRDSSAV---PSIDGRITNGNKAAANQFPY 53
            ||:|:|.:..|         :...|:|...:|   |:|....   |:...||.:||:|..:.:|:
Zfish     8 FALLLLLLGLVLDRASTHAFNPSRLQQHKILHLDWPKDCGLAHFKPNTVERIVSGNEARPHSWPW 72

  Fly    54 QVGLSFKSSAGSWW---CGGSIIANTWVLTAAHC-TKG----ASSVTIYYGSTVRTSAKLKKKVS 110
            ||.|..:......:   |||::|...|||||||| .||    |||..|..|     ..:||:..:
Zfish    73 QVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVLG-----KHQLKRSET 132

  Fly   111 SSKFV--------QHAGYNA-ATLRNDISLIKTPSVTFTVSINKIALPAIASSYSTYA------- 159
            :.:|.        :|..|.| :.|..||:|:|.            |.....|::..||       
Zfish   133 AERFFPVKRIYRHEHFRYPAHSELDYDIALVKA------------ATDIQPSNFIRYACLPRKQI 185

  Fly   160 ----GQTAVASGWG--RTSDSSIAVATNLQYAQFQVITNAVC-QKTFGSSVVTSGVICV---ESI 214
                |.....:|||  |....::::|..|..|:..:|....| ||.|....|...:||.   ::.
Zfish   186 NLNPGHYCWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDSMICAGFRDTE 250

  Fly   215 NKKSTCQGDSGGPLALNN-----RLIGVTSFVSSKGCE-KNAPAGFTRVTSYLDWIK 265
            ...:.|||||||||....     .:.|:.|| ...||. :|.|:.|||..:|:.||:
Zfish   251 GTPAACQGDSGGPLLCQVGRDRWEVHGIVSF-GPIGCTVENKPSVFTRTAAYIPWIE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 79/264 (30%)
Tryp_SPc 40..267 CDD:238113 80/266 (30%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 79/264 (30%)
Tryp_SPc 59..308 CDD:238113 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.