DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and cela1.1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:255 Identity:78/255 - (30%)
Similarity:122/255 - (47%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SIDGRITNGNKAAANQFPYQVGLSFKSSAGSW--WCGGSIIANTWVLTAAHCTKGASSVTIYYGS 97
            :|:.|:..|..|..:.:|:|:.|.:: |.|.:  :|||::|...||:.||||...:...::..|.
Zfish    25 AIEERVIGGEIAKPHSWPWQISLQYQ-SGGRYHHYCGGTLIRPGWVMVAAHCVDTSRIWSVALGD 88

  Fly    98 TVRTSAKLKKKVSSSK--FVQHAGYNAATLR--NDISLIKTPSVTFTVSINKIALPAIASSYSTY 158
            ...|:.:..::..|.|  |: |..:|...:.  |||:|::       :|||     |..|||...
Zfish    89 HDTTTHEGPEQYISVKGVFI-HPNWNPNIVANGNDIALLQ-------LSIN-----ATLSSYVQV 140

  Fly   159 A-----------GQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVC-QKTFGSSVVTSGVICV 211
            |           |.|...:|||||.... :::..|:.|...|:.:..| |..:..|.|...:||.
Zfish   141 ATLPSYGEILPYGHTCYITGWGRTQTGG-SLSAQLKQAYMPVVDHETCSQSDWWGSTVKDRMICA 204

  Fly   212 ESINKKSTCQGDSGGPL--ALNNRLI--GVTSFVSSKGCEK-NAPAGFTRVTSYLDWIKN 266
            ......|.|.||||.||  ..|...:  ||||||:|.||.. ..|..||||:.::.|:.:
Zfish   205 GGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYKKPTVFTRVSYHVSWLNH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 76/247 (31%)
Tryp_SPc 40..267 CDD:238113 76/250 (30%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 76/246 (31%)
Tryp_SPc 30..265 CDD:238113 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.