DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and ctrb.3

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:254 Identity:84/254 - (33%)
Similarity:127/254 - (50%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSIDG--RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYG 96
            |.:.|  ||.||.:|..:.:|:||  |.:...|..:||||:|...||:|||||            
Zfish    26 PVVSGYARIVNGEEAVPHSWPWQV--SLQDFTGFHFCGGSLINEFWVVTAAHC------------ 76

  Fly    97 STVRTSAKL------KKKVSS---------SKFVQHAGYNAATLRNDISLIKTPSVTFTVSINKI 146
             :||||.::      |.|.::         ||...|..||:.|:.|||:|:|   :|...|:|..
Zfish    77 -SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVK---LTAPASLNAH 137

  Fly   147 ALP-AIASSYSTYA-GQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVI 209
            ..| .:|.:...:| |.|.|.||||.|..:::.....||.....:::|..|:..:||: :...:|
Zfish   138 VSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDCKNHWGSN-IRDTMI 201

  Fly   210 CVESINKKSTCQGDSGGPLALNN----RLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            |..:.. .|:|.|||||||....    .|:|:.|:.||: |:...|..:.|||...||:
Zfish   202 CAGAAG-ASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSR-CDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 81/245 (33%)
Tryp_SPc 40..267 CDD:238113 81/246 (33%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 81/245 (33%)
Tryp_SPc 34..261 CDD:238113 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.