DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and ctrl

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:241 Identity:80/241 - (33%)
Similarity:128/241 - (53%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSIDG--RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSV-TIYY 95
            |.:.|  ||.||..|....:|:||  |.:.|.|..:||||:|::.||:|||||  |.::. .:..
 Frog    26 PVLSGYARIVNGENAVPGSWPWQV--SLQDSTGFHFCGGSVISDFWVVTAAHC--GVTTAHRVIL 86

  Fly    96 GSTVRTS-AKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPSVTFTVSINKIALP-AIASSYSTY 158
            |...|:| |:..:..:.:|..:|..||:.|:.|||:|:|..|   ..|.:.|..| .:|||...:
 Frog    87 GEYDRSSPAEPIQTKTIAKVFRHPNYNSFTIANDITLLKLSS---PASFSNIVAPVCVASSSDAF 148

  Fly   159 -AGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQG 222
             .|:..|.:|||....:|......||.....:::|..||:.:||.::.: ::|. ..:..|:|.|
 Frog   149 NGGERCVTTGWGYVDAASRLTPNKLQQVALPLLSNTECQRYWGSKILNT-MVCA-GASGASSCMG 211

  Fly   223 DSGGPLALNNR----LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            ||||||.....    |.|:.|:.||. |..::|..:.||::...|:
 Frog   212 DSGGPLVCQRNGAWVLAGIVSWGSST-CSPSSPGVYARVSTLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 77/232 (33%)
Tryp_SPc 40..267 CDD:238113 77/233 (33%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.