DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Tpsab1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:287 Identity:85/287 - (29%)
Similarity:140/287 - (48%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65
            :::..:|:|.:..:|       :.||...|.|:|. :| |..|.:|:.|::|:||.|....:...
  Rat    36 VRMLKLLLLTLPLLS-------SLVHAAPSLAMPR-EG-IVGGQEASGNKWPWQVSLRVNDTYWM 91

  Fly    66 WWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKK--------VSSSKFVQHAGYNA 122
            .:||||:|...||||||||. |.:.     ....:...:|:|:        ::.|:.:.|..:..
  Rat    92 HFCGGSLIHPQWVLTAAHCV-GPNK-----ADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYI 150

  Fly   123 ATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGR-TSDSSIAVATNLQYA 185
            |....||:|:| |..|..|.:::.::||..:.::.  :|.....:|||. .:|.|:.....|:..
  Rat   151 AQDGADIALLKLTNPVNITSNVHTVSLPPASETFP--SGTLCWVTGWGNINNDVSLPPPFPLEEV 213

  Fly   186 QFQVITNAVCQKTF------GSSV--VTSGVICVESINKKSTCQGDSGGPLALNNR----LIGVT 238
            |..::.|.:|...:      |.:|  |...::|..:....| |||||||||.....    ..||.
  Rat   214 QVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDS-CQGDSGGPLVCKVEDTWLQAGVV 277

  Fly   239 SFVSSKGC-EKNAPAGFTRVTSYLDWI 264
            |:  .:|| :.|.|..:||||.|||||
  Rat   278 SW--GEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 74/247 (30%)
Tryp_SPc 40..267 CDD:238113 76/248 (31%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 74/246 (30%)
Tryp_SPc 66..302 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.