DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and cela1.6

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:289 Identity:84/289 - (29%)
Similarity:129/289 - (44%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65
            :.|.|.|.||......:.:.|:                |:..|..|..|.:|:|:.|.: .|.||
Zfish     7 LSVLAALALAEPRYLEEQIAQE----------------RVVGGEVARPNSWPWQISLQY-LSGGS 54

  Fly    66 WW--CGGSIIANTWVLTAAHCTKGASSVTIYYG--STVRTSAKLKKKVSSSKFVQ--------HA 118
            ::  |||::|...:|||||||...:.:..:..|  ...:...:.:....|:.::.        .|
Zfish    55 YYHTCGGTLIKQNFVLTAAHCVDTSRTWRVVLGEHDIYKQEGREQYMTVSNVYIHPNWNRNNVAA 119

  Fly   119 GYNAATLRNDISLIKTPSVTFTVSINKI-----ALPAIASSYSTYAGQTAVASGWGRTSDSSIAV 178
            ||:.|.||    |....|:...|.:..:     .||...:.|.|         |||.||... ::
Zfish   120 GYDIALLR----LSSNASLNTYVQLGTLPPSGQVLPHNNACYIT---------GWGLTSTGG-SL 170

  Fly   179 ATNLQYAQFQVITNAVCQK-TFGSSVVTSGVICVESINKKSTCQGDSGGPL--ALNNRLI--GVT 238
            :..|:.|...|:....|.: .:..|.|.:.::|... ...|.|||||||||  .::.:.:  |||
Zfish   171 SAQLKQAYLPVVDYNTCSRGDWWGSTVKNTMVCAGG-GSLSGCQGDSGGPLNCQVSGQYVVHGVT 234

  Fly   239 SFVSSKGCEKNA---PAGFTRVTSYLDWI 264
            |||||.||  ||   |..||||::|:.||
Zfish   235 SFVSSSGC--NAYQKPTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 76/249 (31%)
Tryp_SPc 40..267 CDD:238113 77/250 (31%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.