DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and cela1.3

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:287 Identity:88/287 - (30%)
Similarity:138/287 - (48%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65
            :.|.|.||||......||                .|:||:..|..|..|.:|:|:.|.:.|.:..
Zfish    22 LSVLATLVLAEPRYLEDI----------------DIEGRVVGGEVAKPNSWPWQISLQYLSGSSY 70

  Fly    66 W-WCGGSIIANTWVLTAAHCTKGASSVTIYYGS-TVRTSAKLKKKVSSSKFVQHAGYNAATLRN- 127
            : .||||:|...||:|||||.....:..:..|. .:......::.:|.|:...|..:|:.:|.: 
Zfish    71 YHTCGGSLIRPGWVMTAAHCVDSPRTWRVVLGDHDIYNHEGREQYISVSRAHIHPNWNSNSLSSG 135

  Fly   128 -DISLIKTPSVTFTVSINK-IALPAIASSYSTYAGQT------AVASGWGRTSDSSIAVATNLQY 184
             ||:|::..|   ..|:|. :.|.|:..|     ||.      ...||||||.... :::..|:.
Zfish   136 YDIALLELSS---DASLNSYVQLAALPPS-----GQVLPNNNPCYISGWGRTQTGG-SLSAELKQ 191

  Fly   185 AQFQVITNAVCQKT-FGSSVVTSGVICVESINKKSTCQGDSGGPL--ALNNRLI--GVTSFVSSK 244
            |...|:.:..|.:: :..|.|.:.:|| ......:.|.|||||||  .::.:.:  ||||||||.
Zfish   192 AYLPVVDHDTCSRSDWWGSTVKNTMIC-GGDGTLAGCHGDSGGPLNCQVSGQYVVHGVTSFVSSA 255

  Fly   245 GCEKN-APAGFTRVTSYLDWIKNQSGV 270
            ||..| .|..|:||::|:.||.:.|.:
Zfish   256 GCNTNKRPTVFSRVSAYISWINDVSTI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 75/241 (31%)
Tryp_SPc 40..267 CDD:238113 76/243 (31%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.