DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CTRB2

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:251 Identity:81/251 - (32%)
Similarity:128/251 - (50%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGAS 89
            :||     |.|...||.||..|....:|:||.|..|:  |..:||||:|:..||:|||||....|
Human    24 IHP-----VLSGLSRIVNGEDAVPGSWPWQVSLQDKT--GFHFCGGSLISEDWVVTAAHCGVRTS 81

  Fly    90 SVTIY----YGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK--TPSVTFTVSINKIAL 148
            .|.:.    .||.......||    .:|..::..::..|:.|||:|:|  ||: .|:.:::.:.|
Human    82 DVVVAGEFDQGSDEENIQVLK----IAKVFKNPKFSILTVNNDITLLKLATPA-RFSQTVSAVCL 141

  Fly   149 PAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVES 213
            |:....:.  ||.....:|||:|..::......||.|...:::||.|:|::|.. :|..:||. .
Human   142 PSADDDFP--AGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRR-ITDVMICA-G 202

  Fly   214 INKKSTCQGDSGGPLALNN----RLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265
            .:..|:|.|||||||....    .|:|:.|: .|:.|....||.:.||...:.|::
Human   203 ASGVSSCMGDSGGPLVCQKDGAWTLVGIVSW-GSRTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 76/234 (32%)
Tryp_SPc 40..267 CDD:238113 76/236 (32%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 76/234 (32%)
Tryp_SPc 34..259 CDD:238113 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.