DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:274 Identity:133/274 - (48%)
Similarity:169/274 - (61%) Gaps:11/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65
            ||:|..|.||:|..:|    ...|......:.:..|.||||||..|...:.||.|||.| |..|:
  Fly     1 MKLFVFLALAVAAATA----VPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLF-SGNGN 60

  Fly    66 WWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDIS 130
            ||||||||.|||||||||||.|||.|||.||:::||..:....|.|...:||..||:..|.||||
  Fly    61 WWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDIS 125

  Fly   131 LIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVC 195
            ||:||.|.|...:||:.||:....|..|||..|||||||.|.|.| .:...||....|:|:.:.|
  Fly   126 LIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGS-PLPDWLQSVDVQIISQSDC 189

  Fly   196 QKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALN--NRLIGVTSFVSSKGCEKNAPAGFTRVT 258
            .:|:.   :...:||:.:...||||.|||||||..:  |||:|||||.|:.||:..|||.|:|||
  Fly   190 SRTWS---LHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVT 251

  Fly   259 SYLDWIKNQSGVFY 272
            .|||||::.:|:.|
  Fly   252 GYLDWIRDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 118/226 (52%)
Tryp_SPc 40..267 CDD:238113 119/228 (52%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 119/228 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470837
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.