DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG11843

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:280 Identity:80/280 - (28%)
Similarity:119/280 - (42%) Gaps:47/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFK---SSAGSWWCGGSIIANTWV 78
            |..|..||:              |..|:.|...:||:...|..:   ||...|:|||.:|:..:|
  Fly    59 DNCRSYTPL--------------IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFV 109

  Fly    79 LTAAHC---TKGASSVT----IYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TP 135
            ||||||   .:|..:|.    :.:.|....:|.....|:.  ::.|.||......:||.|:| |.
  Fly   110 LTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAG--YIAHPGYEDPQFYHDIGLVKLTE 172

  Fly   136 SVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFG 200
            :|.|.:..:...||    .....:..:.:|.|||.|. .::..:..|...:.|...|.||:|...
  Fly   173 AVVFDLYKHPACLP----FQDERSSDSFIAVGWGSTG-LALKPSAQLLKVKLQRYGNWVCKKLLT 232

  Fly   201 SSVVT-------SGVICVESINKKSTCQGDSGGPLALNNR-------LIGVTSFVSSKGCEKNAP 251
            ..|..       :..:||.|...:.||.|||||||.:.:|       ::|:||...|.| ....|
  Fly   233 RQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIP 296

  Fly   252 AGFTRVTSYLDWIKNQSGVF 271
            ..:|||..||.||......|
  Fly   297 GIYTRVYPYLGWIARTLATF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 73/249 (29%)
Tryp_SPc 40..267 CDD:238113 75/251 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 75/251 (30%)
Tryp_SPc 68..309 CDD:214473 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.