DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG4815

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:284 Identity:58/284 - (20%)
Similarity:101/284 - (35%) Gaps:91/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPR----DSSAVPSIDG---RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAH 83
            |||    ..:.|.|:.|   ::.||.|..                    |..:::....:|||||
  Fly    32 HPRIYNGIKTTVESLGGVGIQLFNGRKLV--------------------CSATLLTPRHILTAAH 76

  Fly    84 CTK-----------GASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPSV 137
            |.:           |.|:...::|:....:..::.::       |..|.......|:::.||.. 
  Fly    77 CFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQI-------HPKYAKMKFIADVAVAKTKY- 133

  Fly   138 TFTVSINKIALPAIASSYSTYA---------GQTAVASGWG----------RTSDSSIAVATNLQ 183
                        .:.|.|..||         ....:|:|||          :.:..|:.|.    
  Fly   134 ------------PLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESRKKTFRSMKVG---- 182

  Fly   184 YAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCEK 248
                 :::...|:|..... :...:||..:.|.|:.|.|||||||.|..::.|:.::....| ..
  Fly   183 -----IVSKRDCEKQLDRK-MPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCG-NN 240

  Fly   249 NAPAGFTRVTSYLDWIK---NQSG 269
            ..|..:..|..|..:||   |:.|
  Fly   241 EKPDVYMGVRYYAKFIKRTINRMG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 48/254 (19%)
Tryp_SPc 40..267 CDD:238113 50/259 (19%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 50/260 (19%)
Trypsin 49..256 CDD:278516 48/257 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.