DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG10232

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:115/290 - (39%) Gaps:74/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PRDSSAVPSIDG------RITNGNKAAANQFPYQVGLSFKSSAGSWW---CGGSIIANTWVLTAA 82
            |...:.:|:..|      |:..|..|..|::|:...|.:::...|..   |.||:|...:|||||
  Fly   238 PEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAA 302

  Fly    83 HCTKGASSVTIYYGSTVRTSAKLKK-------------------------KVSSSKFVQHAGY-N 121
            ||        :.....|.|...|::                         ::....|..|..| |
  Fly   303 HC--------VVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFN 359

  Fly   122 AATLRNDISLIK--TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQY 184
            .:...:||:|::  || |.:|..|..|.:|........:..|.|   |||.|.        |.:|
  Fly   360 TSRFESDIALVRLQTP-VRYTHEILPICVPKDPIPLHNHPLQIA---GWGYTK--------NREY 412

  Fly   185 AQFQVITNAV------CQKTFGSSVVTSGVICVESINKKSTCQGDSGGP--LALNN------RLI 235
            :|. ::.|.|      ||... |.......||...|..:.:|:||||||  |.|||      .|.
  Fly   413 SQV-LLHNTVYENRYYCQDKI-SFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLA 475

  Fly   236 GVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265
            |:.|: .|:.|....|..:|:..::..|||
  Fly   476 GIVSY-GSENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 70/269 (26%)
Tryp_SPc 40..267 CDD:238113 72/271 (27%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 72/268 (27%)
Tryp_SPc 260..503 CDD:214473 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.