DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG16710

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:280 Identity:78/280 - (27%)
Similarity:113/280 - (40%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWW-------CGGSIIANTWVLTAAHCTK---------- 86
            ||..|.:...|:.|:...:.:...:.|.|       |.||:|.|.:|||||||.:          
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    87 --------GASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLR--NDISL--IKTPSVTF 139
                    ....||...|........|:..|..|  ::|..|.....|  |||:|  :|.| |.:
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHLEIDVDLS--IKHRHYMVFEERPYNDIALLRLKFP-VRY 231

  Fly   140 TVSINKIA--LPAIAS--SYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQ------FQVITN-- 192
            |..|..|.  |..|.|  |:|.:..|.|   |||            |.:.|      .|...|  
  Fly   232 TAQIKPICVQLDYIFSNPSFSNHKLQIA---GWG------------LSHKQGYSNVLLQAYVNGR 281

  Fly   193 -----AVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPL-ALNNR-------LIGVTSFVSSK 244
                 ::.:.:.|....|.  ||..::....||:||||||| |:..|       |.|:||:..|:
  Fly   282 NADECSLSEPSLGLDKETH--ICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ 344

  Fly   245 GCEKNAPAGFTRVTSYLDWI 264
             | ...||.:|:.:.:::||
  Fly   345 -C-GYGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 76/278 (27%)
Tryp_SPc 40..267 CDD:238113 77/279 (28%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 76/278 (27%)
Tryp_SPc 106..362 CDD:238113 75/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.